PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AL_409AB7647.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 733aa    MW: 77333.8 Da    PI: 6.8628
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AL_409AB7647.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.31e-30294350259
                            --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            +Dgy+WrKYGqK+vk se+prsYY+Ct+++C+vkkkvers+ +++v+ei+Y+g+Hnh+
  Traes_2AL_409AB7647.1 294 EDGYSWRKYGQKQVKHSEYPRSYYKCTHPSCQVKKKVERSH-EGHVTEIIYKGTHNHP 350
                            8****************************************.***************8 PP

2WRKY104.75e-33522580159
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC+v+k+ver+++d k v++tYeg+Hnhe
  Traes_2AL_409AB7647.1 522 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHPGCSVRKHVERASHDLKSVITTYEGKHNHE 580
                            59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.4E-27288352IPR003657WRKY domain
SuperFamilySSF1182904.05E-25288352IPR003657WRKY domain
PROSITE profilePS5081122.63288352IPR003657WRKY domain
SMARTSM007743.1E-33293351IPR003657WRKY domain
PfamPF031061.7E-23294350IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.0E-37507582IPR003657WRKY domain
SuperFamilySSF1182907.72E-29514582IPR003657WRKY domain
PROSITE profilePS5081137.539517582IPR003657WRKY domain
SMARTSM007744.0E-38522581IPR003657WRKY domain
PfamPF031063.0E-25523580IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 733 aa     Download sequence    Send to blast
MDGHTHLAVE WKDQSPGADC SMLPSFLTDP FPADPLVEDC DGGNDGSEGA GFERHGLSVA  60
VGSPQEEGKP ATPHFGQRSS SSSSLSERMQ ARAGFSVAKL SMPGSEYSGA QSPYLTIPPG  120
LSPASLLESP VFLSNAMGQS SPTTGKLLML GDTNNNNNTR LEPPSIEDRP GAFSFKPLDL  180
KSSQYTAEGK KGSLPNSQHP SAPSRDVPVK TETNIQTTTR GAIPPGHLNQ AQFNNGQDLM  240
KCSYHDCNNK RNRLAADRTT AGGDNNDGPP VTAADSEAAK GDYPAAVATA APAEDGYSWR  300
KYGQKQVKHS EYPRSYYKCT HPSCQVKKKV ERSHEGHVTE IIYKGTHNHP RPAAQGRRPA  360
GGAQVHPFND AQMDAPADNN NNGYGNAGGS QPNAEARSLW HAGVAVQDWR GDGLEATSSP  420
SVPGELCDSS ASMQVHDGAA RFESPEGGVD VTSAVSDEVD GDDRVAHGSM SQGQGAADTT  480
EGDELESKRR KLESCAIDMS TASRAVREPR VVIQTTSEVD ILDDGYRWRK YGQKVVKGNP  540
NPRSYYKCTH PGCSVRKHVE RASHDLKSVI TTYEGKHNHE VPAARNGGHG SSAASGGTGA  600
SQLSHARRAE PPSVQDGLMR LGGCGAPFGL PPRDPLGPMS NYPYSLGGGH AXXLPMPSGL  660
GAVEGLKLPM LSPSLHSVFR QRQAMETAAG FRVPKGEVKD EAAGAGAGAG GGAAAAAAYP  720
QTMMSRLPLG HRM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-36294583878Probable WRKY transcription factor 4
2lex_A2e-36294583878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3767650.0AK376765.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3135C08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014751041.10.0PREDICTED: probable WRKY transcription factor 20 isoform X1
TrEMBLW5ARI50.0W5ARI5_WHEAT; Uncharacterized protein
STRINGMLOC_77883.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP207538100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-106WRKY DNA-binding protein 2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]